Protein Info for CSW01_17275 in Vibrio cholerae E7946 ATCC 55056

Annotation: large conductance mechanosensitive channel protein MscL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details PF01741: MscL" amino acids 3 to 131 (129 residues), 162.3 bits, see alignment E=3.4e-52 TIGR00220: large conductance mechanosensitive channel protein" amino acids 3 to 133 (131 residues), 168.9 bits, see alignment E=2.8e-54

Best Hits

Swiss-Prot: 100% identical to MSCL_VIBC3: Large-conductance mechanosensitive channel (mscL) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 100% identity to vch:VCA0612)

MetaCyc: 64% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>CSW01_17275 large conductance mechanosensitive channel protein MscL (Vibrio cholerae E7946 ATCC 55056)
MSLLKEFKAFASRGNVIDMAVGIIIGAAFGKIVSSFVADIIMPPIGIILGGVNFSDLSFV
LLAAQGDAPAVVIAYGKFIQTVVDFTIIAFAIFMGLKAINSLKRKEEEAPKAPPAPTKDQ
ELLSEIRDLLKAQQDK