Protein Info for CSW01_17250 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphonoacetaldehyde hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF00702: Hydrolase" amino acids 6 to 200 (195 residues), 62.5 bits, see alignment E=7.3e-21 TIGR01422: phosphonoacetaldehyde hydrolase" amino acids 6 to 259 (254 residues), 381.6 bits, see alignment E=1.5e-118 PF13419: HAD_2" amino acids 9 to 205 (197 residues), 33 bits, see alignment E=6.5e-12 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 37 to 205 (169 residues), 62.2 bits, see alignment E=6.3e-21

Best Hits

Swiss-Prot: 100% identical to PHNX_VIBC3: Phosphonoacetaldehyde hydrolase (phnX) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K05306, phosphonoacetaldehyde hydrolase [EC: 3.11.1.1] (inferred from 100% identity to vcj:VCD_000713)

MetaCyc: 77% identical to phosphonoacetaldehyde hydrolase (Vibrio splendidus)
Phosphonoacetaldehyde hydrolase. [EC: 3.11.1.1]

Predicted SEED Role

"Phosphonoacetaldehyde hydrolase (EC 3.11.1.1)" in subsystem Phosphonate metabolism (EC 3.11.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>CSW01_17250 phosphonoacetaldehyde hydrolase (Vibrio cholerae E7946 ATCC 55056)
MMNSPIQAVIFDWAGTIVDFGSFAPTSIFVEAFKQGFDFEISLAEAREPMGLGKWQHIEA
VGKLPTVAQRWQKQFGRPMQASDIDAIYAAFMPLQIAKVADHAAPIPHSLEVVEQIRSRG
IKIGSCSGYPRQVMDVLIAAAADYGYRPDYVVATDDLAQGGRPAPFMALKNVIELGVTDV
RACVKVDDALPGIEEGHNAGMWTVGLLLSGNEAGLTLEEYQHADDQTLQAARERAQAKLQ
QAKPHYLIDTVADLPAVLAQIEQRLLAGERP