Protein Info for CSW01_17235 in Vibrio cholerae E7946 ATCC 55056

Annotation: putative 2-aminoethylphosphonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR03261: putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein" amino acids 11 to 336 (326 residues), 501.8 bits, see alignment E=4.3e-155 PF13531: SBP_bac_11" amino acids 32 to 245 (214 residues), 36.5 bits, see alignment E=7.2e-13 PF01547: SBP_bac_1" amino acids 43 to 279 (237 residues), 54.4 bits, see alignment E=3.1e-18 PF13343: SBP_bac_6" amino acids 89 to 300 (212 residues), 73.6 bits, see alignment E=2.7e-24

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 100% identity to vco:VC0395_0545)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>CSW01_17235 putative 2-aminoethylphosphonate ABC transporter substrate-binding protein (Vibrio cholerae E7946 ATCC 55056)
MERMMNKRILKGTLTAIAALMSAHAFAGQEVTVYTAFETDLLAKYKSAFEKENPDIEIKW
VRDSTGIMTAKLLAEKDNPRAEVVWGLAGSSMALLKDQGVLKPYTPKGANELRANLNDPQ
AQQAWYGNDAFFNAVCFNEAVAKQLNLPKPQSWEDLTNPVYKGHIAMPNPASSGTGYMQV
SAWLQNMGEDKAWDYMQRLDQNIAHYTHSGSKPCVQAGMGEVAIGISMATRGAKLKTQGA
PLDVIVPNGIGWESEAVGLVKESDAAKRVVDWSVSKAANELYIESYPIVGHQDVSKQVPN
YPNVEKVMAKMDFTQMGVDRARVLQTWSEKFDAKSEPKS