Protein Info for CSW01_17175 in Vibrio cholerae E7946 ATCC 55056

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details amino acids 46 to 47 (2 residues), see Phobius details transmembrane" amino acids 34 to 45 (12 residues), see Phobius details amino acids 48 to 48 (1 residues), see Phobius details amino acids 147 to 172 (26 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details PF12911: OppC_N" amino acids 20 to 54 (35 residues), 29.6 bits, see alignment 5.1e-11 PF00528: BPD_transp_1" amino acids 166 to 347 (182 residues), 101.1 bits, see alignment E=6.4e-33

Best Hits

Swiss-Prot: 70% identical to YEJE_ECOLI: Inner membrane ABC transporter permease protein YejE (yejE) from Escherichia coli (strain K12)

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 100% identity to vcm:VCM66_A0548)

MetaCyc: 70% identical to putative oligopeptide ABC transporter membrane subunit YejE (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>CSW01_17175 ABC transporter permease (Vibrio cholerae E7946 ATCC 55056)
MMGMTKASKRVPNPLTEARWARFKANRRGFWSLWIFLLLFVVSLFAELIANDKPLLIQYD
GAWYMPIVQRYSETQFGGEFDTEADYTDPYVVSLIEEKGQIIWPLIRFHYDTINFDITGS
VPSAPDSVNWLGTDDKGRDVLARIIYGFRISVLFGFILTVISSLIGVLIGATQGYYGGWL
DLFGQRFIEVWSGMPTLFLLIILSSFVEPNFWWLLGIMVLFSWMSLVGVVRAEFLRCRNF
DYVRAAQAMGVSDMRIILRHMLPNAMVASLTMMPFILSGSVTTLTSLDFLGFGLPAGSPS
LGELLAQGKANLQAPWLGISAFVVLSVMLTLLVFIGEAVRDAFDPHLQRSRA