Protein Info for CSW01_17085 in Vibrio cholerae E7946 ATCC 55056

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01820: Dala_Dala_lig_N" amino acids 6 to 106 (101 residues), 68.6 bits, see alignment E=1.1e-22 TIGR01205: D-alanine--D-alanine ligase" amino acids 6 to 329 (324 residues), 359.4 bits, see alignment E=7.4e-112 PF02222: ATP-grasp" amino acids 125 to 296 (172 residues), 31.5 bits, see alignment E=2.1e-11 PF07478: Dala_Dala_lig_C" amino acids 126 to 326 (201 residues), 178.1 bits, see alignment E=2.4e-56

Best Hits

Swiss-Prot: 100% identical to DDL_VIBCM: D-alanine--D-alanine ligase (ddl) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 100% identity to vcj:VCD_000746)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>CSW01_17085 D-alanine--D-alanine ligase (Vibrio cholerae E7946 ATCC 55056)
MTKTTILLLCGGGSSEHEISLVSANYIQQQLELTPEFHVIRVEMKKEGWFSEQGALVYLD
TNSATLNSDKASYPIDFVVPCIHGFPGETGDIQSMLELAGIPYLGCGPEASANSFNKITS
KLWYDALDIPNTPYLFLTQNTPSSIDKAKQAFGHWGSIFVKAARQGSSVGCYKVTTEDQI
APAIEAAFGFSEQVLVEQAVKPRELEVSAYEMNGKLYISKPGEVIAPEGTFYSYEEKYSA
NSHARTVLEAENLTEKHKELIQTYAERVFIHMKLRHLSRIDFFLTQEGQIYLNEVNTFPG
MTPISMFPKMLEHNGHRFSEFLVQCVTNTLVNAK