Protein Info for CSW01_16950 in Vibrio cholerae E7946 ATCC 55056

Annotation: ATP-dependent endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF11398: DUF2813" amino acids 12 to 380 (369 residues), 530 bits, see alignment E=8.8e-163 PF13175: AAA_15" amino acids 12 to 92 (81 residues), 41.7 bits, see alignment E=2.3e-14 PF13476: AAA_23" amino acids 16 to 236 (221 residues), 27.3 bits, see alignment E=1.1e-09 PF20469: OLD-like_TOPRIM" amino acids 381 to 445 (65 residues), 60 bits, see alignment E=5.3e-20

Best Hits

KEGG orthology group: K07459, putative ATP-dependent endonuclease of the OLD family (inferred from 100% identity to vcj:VCD_000783)

Predicted SEED Role

"Predicted ATP-dependent endonuclease of the OLD family, YbjD subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (554 amino acids)

>CSW01_16950 ATP-dependent endonuclease (Vibrio cholerae E7946 ATCC 55056)
MGPGEESKEQPMHLERIEIAGFRGIRRLSLTFDEITTLIGENTWGKSSLLDALSVVLPAD
GTLYPFTLQDFHVDYSIADAQTQNLQIILVFAANDLHEPKAGRYRKLKPLWQTDEQGAQK
IIYRISASRVKYDISTQYAFLDLEGNSLTLHHSEKLAQELMSLHPVIRLKDSRRFEKSLA
NGNGKNARVEKRISNTWRRLMATPGHVNKGEIRSSLSAMNSLVEHYFSFKSQSRKNPRRE
RDSLLYAASPSEKSLSQIIHETKNKQTKLLLLGLLNAYLQGKGPKELRRCARPILIIEDP
EGRLHPTHLARAWSFLDLLPMQKILTTNSSDLLGAVPLHSIRRLVRKSDRTIATSVSQRS
LSRDELRRIGFHIRFHRSGALFARCWLLVEGETEVWLFNELAHQCGYNLAAEGVHIIEFA
QSGLKSLIKVARAFGIDWHVVTDGDPAGKKYSATVRGLLGHDQERHRLTELPDRDIEHFL
YSHGFEYFFKELVKIPHDHPIPAKKVVSKVLKKHAKPDLALAIVSHCESNGTECIPVLLR
WTLKRVITMANGNT