Protein Info for CSW01_16900 in Vibrio cholerae E7946 ATCC 55056

Annotation: twin-arginine translocase TatA/TatE family subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01411: twin arginine-targeting protein translocase, TatA/E family
  • amino acids 3 to 48 (46 residues), 64.7 bits, E=2.1e-22
• PF02416: TatA_B_E
  • amino acids 4 to 52 (49 residues), 43.1 bits, E=9.7e-16

Best Hits

Swiss-Prot: 49% identical to TATE_KLEP7: Probable Sec-independent protein translocase protein TatE (tatE) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03116, sec-independent protein translocase protein TatA (inferred from 100% identity to vcm:VCM66_A0492)

MetaCyc: 39% identical to twin arginine protein translocation system - TatA protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatA" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Protein Sequence (78 amino acids)

>CSW01_16900 twin-arginine translocase TatA/TatE family subunit (Vibrio cholerae E7946 ATCC 55056)
MGGISVGKLLILGCIVALVFGTKKLRTIGEDAGYAIRSFQKALRGDEVTTQSSTAEESVD
SFAIEQESSHSSDSQRHS