Protein Info for CSW01_16860 in Vibrio cholerae E7946 ATCC 55056

Annotation: tellurium resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 281 to 305 (25 residues), see Phobius details PF03595: SLAC1" amino acids 11 to 300 (290 residues), 74.5 bits, see alignment E=4.4e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to vch:VCA0524)

Predicted SEED Role

"Tellurite resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>CSW01_16860 tellurium resistance protein (Vibrio cholerae E7946 ATCC 55056)
MNWHRFTQVQNVPPSQAALALGMIGLGHAWVLYYPAVGMVIRPYLAFSGALLLLPVLLKY
LHWRTFINDLRHPVSGSLMAPMSMALLILCDYLAILSPFIAYPIWAAALLLHLTMMTLFF
YFQLRQFKLANIVPSWFLYPVGVISSSLAGTQFGHTLFSETMVNVCIAIYFVMLPLVLYR
LVFAGTLPKRARPTLAIMAAPINLTLATYLVNFAQPDPILTGALAGIAITMTLLIYLCYL
RLLRLQFQPSIAAVTFPSVISAVAMQRLTEFFATDHPHWYWLHYFGFLEVTIATLLVAWV
SWGYIKMYWPELFKNRSVNS