Protein Info for CSW01_16840 in Vibrio cholerae E7946 ATCC 55056

Annotation: exonuclease sbcCD subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF00149: Metallophos" amino acids 1 to 218 (218 residues), 63.1 bits, see alignment E=7.3e-21 TIGR00619: exonuclease SbcCD, D subunit" amino acids 1 to 245 (245 residues), 187.6 bits, see alignment E=1.8e-59 PF12850: Metallophos_2" amino acids 1 to 238 (238 residues), 27.7 bits, see alignment E=3.7e-10 PF12320: SbcD_C" amino acids 267 to 353 (87 residues), 51.5 bits, see alignment E=1.7e-17

Best Hits

KEGG orthology group: K03547, exonuclease SbcD (inferred from 100% identity to vcm:VCM66_A0479)

Predicted SEED Role

"Exonuclease SbcD" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>CSW01_16840 exonuclease sbcCD subunit D (Vibrio cholerae E7946 ATCC 55056)
MKFLHTSDWHLGRQFHQVSLLDDQSAVLAQLIDFLRDNPVDAVIVAGDIYDRSIPPTAAI
DLLDEVVSVICGELKTPLLMIPGNHDGAKRLGFAAKQMKNSGLHIFADFEQMMQPLVLHS
PQAGEVAFWGMPYHDPELVRHYYHNDITTHDAAHQFLCESILAQRNPSQRHVLISHCFVD
GAMESESERPLSIGGSDRVDHRHFLPFDYVALGHLHQPQMKGAEHIRYSGSLMKYSFGEQ
HQNKGATLVELGQQGFISATHIPLIAPHQMRIIEGELEAILAAGATDPQADDYLLVRLLD
KHAILDPMEKLRQVYPNVLHLEKPGMLIGVDQEMGKARLARGELDMFRDFFLEAKREPLS
EQQEKVVIEVIARLKAEGI