Protein Info for CSW01_16835 in Vibrio cholerae E7946 ATCC 55056

Annotation: catabolite repressor/activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF00356: LacI" amino acids 2 to 50 (49 residues), 58.1 bits, see alignment 8.8e-20 TIGR02417: D-fructose-responsive transcription factor" amino acids 2 to 325 (324 residues), 457.7 bits, see alignment E=1.2e-141 PF00532: Peripla_BP_1" amino acids 63 to 211 (149 residues), 53.8 bits, see alignment E=3.1e-18

Best Hits

KEGG orthology group: K03435, LacI family transcriptional regulator, fructose operon transcriptional repressor (inferred from 100% identity to vco:VC0395_0452)

Predicted SEED Role

"Fructose repressor FruR, LacI family" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>CSW01_16835 catabolite repressor/activator (Vibrio cholerae E7946 ATCC 55056)
MTLDEIAKLAGVSKTTASYVINGKAQKYRISEKTQHKVMAVVEQYNFRPDHAASALRAGN
SRSFGLIIPDLENTSYARLAKLLEQNSRQAGYQILIACSDDDPQIEMAAAEALVSRRIDA
LFVASGIPSASEYYLKLQQSGTPVIAIDRALDDEYFSCVISEDFGAAFELTRSVLTQDVH
SVGLVGALPELNVSREREQGFAMAVKQRGLPTTLGYGEHFNREEGRKVFAKWVANDQLPD
AVVATSYTLLEGILDVLLEQPELMQKVRLATFGDNRLLDFLPIRVNSLPQQFELIADSAL
ALALNASAKRYQTGIELIPRQLKVRT