Protein Info for CSW01_16810 in Vibrio cholerae E7946 ATCC 55056

Annotation: aspartate/tyrosine/aromatic aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF00155: Aminotran_1_2" amino acids 27 to 389 (363 residues), 231 bits, see alignment E=1.3e-72

Best Hits

Swiss-Prot: 43% identical to AAT_SALTY: Aspartate aminotransferase (aspC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00813, aspartate aminotransferase [EC: 2.6.1.1] (inferred from 100% identity to vcj:VCD_000814)

MetaCyc: 45% identical to aspartate aminotransferase (Pseudoalteromonas translucida TAC125)
Aspartate transaminase. [EC: 2.6.1.1]

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>CSW01_16810 aspartate/tyrosine/aromatic aminotransferase (Vibrio cholerae E7946 ATCC 55056)
MFTHLPAPVLDPILSLSVAFRNDPRPQKVDLGIGVYKNSLGETPIMRAVALAQDKVVASQ
KTKSYVGLAGCEEFNQSMMQLVLGSTLDTERTIAIQTPGASGALRMLGDLMRVAQPDTTV
WITDPSYVNHKPVMEAAGLKVRYYRYFSRETKMVDTEQMLADLAQAGTKDVVLLHGCCHN
PTGADIDFSAWQAITELAQKNGFIPFVDIAYQGFGDGLEQDAQGLRYMAERMEEMLITTS
CSKNFGLYRERTGAAIVIGKNQQEVTNARGKMLTLARSTYTMPPDHGAALVKTVLRDEQL
TAIWKQELSEMQQRLLTLRKNLCNELRNQHNTRQFDFIESHRGMFTVLGFSAEQMGRLRE
EFAIYGVADGRINIAGLTEKDIPYVANAIIHVS