Protein Info for CSW01_16805 in Vibrio cholerae E7946 ATCC 55056

Annotation: anaerobic ribonucleoside-triphosphate reductase activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 TIGR02491: anaerobic ribonucleoside-triphosphate reductase activating protein" amino acids 2 to 152 (151 residues), 204.3 bits, see alignment E=4.7e-65 PF13353: Fer4_12" amino acids 12 to 151 (140 residues), 193.5 bits, see alignment E=9.7e-62

Best Hits

Swiss-Prot: 100% identical to NRDG_VIBCH: Anaerobic ribonucleoside-triphosphate reductase-activating protein (nrdG) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K04068, anaerobic ribonucleoside-triphosphate reductase activating protein [EC: 1.97.1.4] (inferred from 99% identity to vco:VC0395_0446)

MetaCyc: 67% identical to anaerobic ribonucleoside-triphosphate reductase activating protein (Escherichia coli K-12 substr. MG1655)
1.97.1.-

Predicted SEED Role

"Ribonucleotide reductase of class III (anaerobic), activating protein (EC 1.97.1.4)" in subsystem Ribonucleotide reduction (EC 1.97.1.4)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>CSW01_16805 anaerobic ribonucleoside-triphosphate reductase activating protein (Vibrio cholerae E7946 ATCC 55056)
MNYHQYYPIDVVNGPGTRCTLFVSGCVHQCKGCYNQSTWSLSSGHRYTQEMEDKIIADLK
DTRIKRRGLSLSGGDPMHPANLSAVLQLVQRVKTECPDKDIWLWTGYTLAELDDSQQALL
PYIDVLVDGKFIQEQADPGLEWRGSANQVIHRFTL