Protein Info for CSW01_15470 in Vibrio cholerae E7946 ATCC 55056

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 5 to 199 (195 residues), 178.5 bits, E=1.6e-56
• PF08659: KR
  • amino acids 7 to 171 (165 residues), 52.3 bits, E=1e-17
• PF13561: adh_short_C2
  • amino acids 14 to 250 (237 residues), 179.6 bits, E=1.2e-56

Best Hits

Swiss-Prot: 62% identical to YGFF_ECOLI: Uncharacterized oxidoreductase YgfF (ygfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_000979)

Predicted SEED Role

"3-hydroxyacyl-CoA dehydrogenase [isoleucine degradation] (EC 1.1.1.35)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module (EC 1.1.1.35)

MetaCyc Pathways

• oleate β-oxidation (29/35 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (5/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• fatty acid β-oxidation I (generic) (6/7 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• fatty acid salvage (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• adipate biosynthesis (3/5 steps found)
• adipate degradation (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• valproate β-oxidation (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (8/14 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• benzoyl-CoA degradation I (aerobic) (2/7 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• phenylacetate degradation I (aerobic) (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• superpathway of phenylethylamine degradation (4/11 steps found)
• 3-phenylpropanoate degradation (3/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (8/18 steps found)
• methyl tert-butyl ether degradation (2/10 steps found)
• L-tryptophan degradation III (eukaryotic) (3/15 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• platensimycin biosynthesis (6/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (2/22 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (8/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (4/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Bile acid biosynthesis
• Biosynthesis of plant hormones
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Lysine degradation
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.35

Use Curated BLAST to search for 1.1.1.35

Protein Sequence (250 amino acids)

>CSW01_15470 NAD(P)-dependent oxidoreductase (Vibrio cholerae E7946 ATCC 55056)
MSVQKVVVITGGSRGIGAATAKLFAQNGFSVCINYKSNAEAANTLVEEIKALGGHCIAVQ
ADVSKESDVVKLFETVDQELGVVSVLVNNAGILKKQMRLDEMSAERINSILINNVTGYFL
CCRETVKRMSTRHGGFGGVIVNVSSGAARTGSPNEYIDYAASKGAIDTLTKGLSLEVAAE
GIRVNCVRPGLIYTDMHADGGEPDRIERLKNKIPMQRGGLPDEVAEAIYWLSSEKSSFST
GNFLDLAGGL