Protein Info for CSW01_15210 in Vibrio cholerae E7946 ATCC 55056

Annotation: L-ascorbate 6-phosphate lactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF13483: Lactamase_B_3" amino acids 42 to 282 (241 residues), 40.8 bits, see alignment E=2.3e-14 PF12706: Lactamase_B_2" amino acids 97 to 283 (187 residues), 42.4 bits, see alignment E=6e-15

Best Hits

Swiss-Prot: 70% identical to ULAG_SALHS: Probable L-ascorbate-6-phosphate lactonase UlaG (ulaG) from Salmonella heidelberg (strain SL476)

KEGG orthology group: K03476, L-ascorbate 6-phosphate lactonase [EC: 3.1.1.-] (inferred from 100% identity to vco:VC0395_0981)

MetaCyc: 70% identical to L-ascorbate-6-phosphate lactonase (Escherichia coli K-12 substr. MG1655)
3.1.1.-

Predicted SEED Role

"Probable L-ascorbate-6-phosphate lactonase UlaG (EC 3.1.1.-) (L-ascorbate utilization protein G)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 3.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>CSW01_15210 L-ascorbate 6-phosphate lactonase (Vibrio cholerae E7946 ATCC 55056)
MSKVNEITRESWILSTFPEWGTWLNEEIEQTVVEPNTFSMWWLGCTGIWLKSAGNTNLSI
DFWCGTGKKTQKNRLMNTQHQMMRMGGVEALQPNLRTSIFPLDPFAIKEIDAVLASHDHA
DHIDVNVAAAVLQNCGEHVKFIGPQACVDLWLGWGVPQERCIVAKVGDVLEIGDVKIRVL
DSFDRTALVTLPKGVSSYDKAILDGMDERAVNYLIETSGGSVYHSGDSHYSNYYAKHGND
YQIDVALLSYGENPRGVTDKMTSSDVLRAAESLDCQVVVPFHHDIWANFQNDPREIEVLW
NMKKDRLQYQFAPFFWQVGGKYTYPTDKGRMHYQHFRGFQDIFKNEPELPYKAFL