Protein Info for CSW01_15050 in Vibrio cholerae E7946 ATCC 55056

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 33 to 60 (28 residues), see Phobius details amino acids 80 to 106 (27 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 164 to 191 (28 residues), see Phobius details amino acids 203 to 228 (26 residues), see Phobius details amino acids 271 to 296 (26 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 390 to 417 (28 residues), see Phobius details amino acids 424 to 446 (23 residues), see Phobius details amino acids 475 to 492 (18 residues), see Phobius details amino acids 497 to 517 (21 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 168 to 494 (327 residues), 289.5 bits, see alignment E=1.6e-90

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_A0209)

Predicted SEED Role

"Predicted lysine transporter, NhaC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>CSW01_15050 Na+/H+ antiporter (Vibrio cholerae E7946 ATCC 55056)
MRSMNLAPYSDSVYSVIPPLLAVLLAITTRRVLLSLGAGIVAGAVMLNHFSPLSTVQYLF
GKISGLFWAEGAANSDNINMLLFMLLLGGLISLMTASGATRAFAVWAERKCKDRRSAKAL
TGLMVFAFFIDDFFHSLSVGAICRPVTDRFQISRAKLAYLLDSTAAPVCVITPISSWGAY
IIALIGGILAAHEMTEISAISAFVQMIPMNLYAVFTLLMVLAVIFLPMDIGPMRQHEAWA
REGKLWDESKGRPAGLDMEGGETARGTMIDMVLPIAVLTITTLIFMIQTGNAVLAANGEA
FSLIGALENTNVAQSLVYAALCSLAVSIVLSLRLKLSAQTWLSTAPKGVMAMMPAIIILL
FAWTIGGVVRDLQTGIYLASLTQGNLPVELLPALVFVLSCLMAFATGTSWGTFGIMLPLA
GDIAAASDISLMLPTLSAVLAGAVFGDHASPISSTSILSATGAGSHHIDHVVTQLPYAIS
AAMGALLGYLAMGLLHSVWAGLAASSVWFVLFCAFNLRQKRWQQEPVEA