Protein Info for CSW01_15015 in Vibrio cholerae E7946 ATCC 55056

Annotation: anaerobic C4-dicarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 7 to 38 (32 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 235 to 252 (18 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 365 to 389 (25 residues), see Phobius details amino acids 417 to 439 (23 residues), see Phobius details PF03605: DcuA_DcuB" amino acids 5 to 373 (369 residues), 494.1 bits, see alignment E=1.2e-152 TIGR00770: transporter, anaerobic C4-dicarboxylate uptake (Dcu) family" amino acids 6 to 440 (435 residues), 487.1 bits, see alignment E=2.6e-150

Best Hits

Swiss-Prot: 47% identical to DCUB_ECOL6: Anaerobic C4-dicarboxylate transporter DcuB (dcuB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07792, anaerobic C4-dicarboxylate transporter DcuB (inferred from 100% identity to vcm:VCM66_A0201)

MetaCyc: 47% identical to anaerobic C4-dicarboxylate transporter DcuB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-106; TRANS-RXN-106A; TRANS-RXN-106B; TRANS-RXN-299; TRANS-RXN0-499

Predicted SEED Role

"C4-dicarboxylate transporter DcuB"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>CSW01_15015 anaerobic C4-dicarboxylate transporter (Vibrio cholerae E7946 ATCC 55056)
MLYVEFLFLLLMLYIGSRYGGIGLGVVSGIGLVIEVFVFKMPPTSPPITVMLIILAVVTC
ASILEAAGGLKYMLQVAERMLRKNPKRVTLIAPFVTYTMTFMLGTGHAVYSIMPIIGDVA
LKNGIRPERPMAAASVASQIAITASPISAAVVYYLAELANINHNITLLSILMVTIPATLF
GTLLMSLYSLRRGKELDNDPEYQARLQDPVWREKILNTTATSLDETLPASARNSVLLFIS
SILVIVVIAMWPEIRTIQEGTKPIGMDMVIQMIMLCFGGIILLATKTDPRSVPNGVVFKS
GMVAAIAIFGIAWMSDTYFQYAMPQFKSGIVEMVTNYPWTFALALFIVSVVVNSQAAVAR
MMLPVGLGLGLEPALLIGLMPALYGYFFIPNYPSDIATVNFDNTGTTKIGKWYFNHSFMA
VGLISVISACCVGFVLSKIIIG