Protein Info for CSW01_14995 in Vibrio cholerae E7946 ATCC 55056

Annotation: IS200/IS605 family transposase IS1004

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF01797: Y1_Tnp" amino acids 11 to 129 (119 residues), 139.6 bits, see alignment E=2.8e-45

Best Hits

Swiss-Prot: 41% identical to T200_SALTI: Transposase for insertion sequence element IS200 (tnpA1) from Salmonella typhi

KEGG orthology group: K07491, putative transposase (inferred from 99% identity to vco:VC0395_A2146)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>CSW01_14995 IS200/IS605 family transposase IS1004 (Vibrio cholerae E7946 ATCC 55056)
MGDYRSSSHVYWRCKYHIVWTPKFRFKILKGNVAKELNRSIYILCNMKDCEVLELNVQPD
HVHLVAIIPPKVSISTLMGVLKGRSAIRLFNKFPHIRKKLWGNHFWARGYFVDTVGVNEE
IIRRYVRHQDKKELEQEQQLELLRD