Protein Info for CSW01_14945 in Vibrio cholerae E7946 ATCC 55056

Annotation: 2-hydroxyacid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 5 to 328 (324 residues), 117.8 bits, E=2.7e-38
• PF02826: 2-Hacid_dh_C
  • amino acids 111 to 298 (188 residues), 167 bits, E=2.9e-53

Best Hits

Swiss-Prot: 64% identical to LDHD_ECOLI: D-lactate dehydrogenase (ldhA) from Escherichia coli (strain K12)

KEGG orthology group: K03778, D-lactate dehydrogenase [EC: 1.1.1.28] (inferred from 100% identity to vcm:VCM66_A0188)

MetaCyc: 64% identical to D-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
D-lactate dehydrogenase. [EC: 1.1.1.28]

Predicted SEED Role

"D-lactate dehydrogenase (EC 1.1.1.28)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.28)

MetaCyc Pathways

• mixed acid fermentation (15/16 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• L-alanine degradation II (to D-lactate) (3/3 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• pyruvate fermentation to (R)-lactate (1/1 steps found)
• heterolactic fermentation (13/18 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• vancomycin resistance I (1/3 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (5/9 steps found)
• L-alanine degradation VI (reductive Stickland reaction) (2/6 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.28

Protein Sequence (331 amino acids)

>CSW01_14945 2-hydroxyacid dehydrogenase (Vibrio cholerae E7946 ATCC 55056)
MLNVIFFSAKHYDIASFSKLVDPTQLSLHFHDFRLTDKTAQMAKGCEVVCAFVNDELHAS
VLEQLYQGGTRLIAMRCAGFDKVDLEAAKRLGMQVVRVPAYSPEAVAEHTVGMMLCLNRR
FHKAYQRTRDANFSLDGLVGFNFHGKTVGVIGSGKIGVATMRILQGLGMQILCFDPYPNP
DAIALGARYVELSELFAQSDVITLHCPMSKENYHLLNESAFDQMKDGVMIINTSRGELLD
SVAAIEALKRGRIGALGLDVYDNEKDLFFQDKSNDVIVDDVFRRLSACHNVLFTGHQAFL
TEDALNNIAQTTLNNIQLFFDNQASGNELIQ