Protein Info for CSW01_14940 in Vibrio cholerae E7946 ATCC 55056

Annotation: bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 TIGR00197: YjeF family N-terminal domain" amino acids 13 to 214 (202 residues), 164.5 bits, see alignment E=2.6e-52 PF03853: YjeF_N" amino acids 34 to 193 (160 residues), 169.9 bits, see alignment E=4.9e-54 TIGR00196: YjeF family C-terminal domain" amino acids 235 to 492 (258 residues), 223.1 bits, see alignment E=4.4e-70 PF01256: Carb_kinase" amino acids 253 to 486 (234 residues), 204.8 bits, see alignment E=1.5e-64

Best Hits

Swiss-Prot: 100% identical to NNR_VIBCH: Bifunctional NAD(P)H-hydrate repair enzyme Nnr (nnr) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_000058)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>CSW01_14940 bifunctional ADP-dependent NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase (Vibrio cholerae E7946 ATCC 55056)
MDTIMPLPTHFYTTQQLKQGEQDAASERGLELFHLMERAGQAVFTIAFAQYPTSHHWLIC
CGGGNNGGDGYIVAVLARHMGIDVTVWQLGDPEKLPADAHRAYQQWKELGGAVYAPQSEV
PESTDVIIDALFGIGLKEVLRPQVVPLVELLNQSGKPIVAVDVPSGLCADTGQVMGTCIK
AQHTVSLIGLKQGLVTGQARCYVGTLHYAGLGVEEVFAQHNTPSLVSIDGKLRHSLLPPR
QACTHKGQNGKALIVGGNEGMGGALILCASACARSGAGLSAAMTHPDNVTAMLTITPEVM
STSWNKQHLFEERIEWCDALALGPGLGRDAQAQQIMQRLSSLKVPKVWDADALYFLAHNP
SYDAQRIITPHPVEAARLLGCEVEEVEQDRFAAIRQLQQRYGGVVVLKGAGTLVDDGKEI
AVCLQGNPGMASGGMGDVLTGIIVALLAQKIPLADAAKLGVWLHSSAADLNTKSHGQRGL
LASDLLPHLRELLN