Protein Info for CSW01_14865 in Vibrio cholerae E7946 ATCC 55056

Annotation: MoxR family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF20030: bpMoxR" amino acids 7 to 183 (177 residues), 68.9 bits, see alignment E=8.5e-23 PF00493: MCM" amino acids 27 to 148 (122 residues), 28.2 bits, see alignment E=2.4e-10 PF07728: AAA_5" amino acids 36 to 164 (129 residues), 45.2 bits, see alignment E=2.4e-15 PF07726: AAA_3" amino acids 36 to 166 (131 residues), 207.6 bits, see alignment E=1.4e-65 PF17863: AAA_lid_2" amino acids 246 to 309 (64 residues), 77.1 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 100% identity to vco:VC0395_1103)

Predicted SEED Role

"MoxR-like ATPase in aerotolerance operon"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>CSW01_14865 MoxR family ATPase (Vibrio cholerae E7946 ATCC 55056)
MSFQSFQTLQHYLNQQVIGQTDFINQLLIALLADGHILVEGPPGLAKTRAVKSLADCIEG
DFHRIQFTPDLLPADLTGSDVYRPETGEFVFQSGPIFNALVLADEINRAPAKVQAAMLEA
MAEKQISAGRKTYRLPELFLVMATQNPIEQEGTYPLPEAQLDRFLLHLEVNYPNAEDELA
ILRLNRGEAKGQQAINKPLLTQQQVFSARQEVLNVHMAEAIENYLVRLVMATRHPANYDA
KLAQWLTMGVSPRATIALDRCARAHAWLQGRDFVTPDDVQVMAFSVLRHRLLLSYQAQAE
GIHPNKIISHLLSLVGSA