Protein Info for CSW01_14780 in Vibrio cholerae E7946 ATCC 55056

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 28 to 47 (20 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details PF00420: Oxidored_q2" amino acids 6 to 111 (106 residues), 82.7 bits, see alignment E=6.4e-28

Best Hits

Swiss-Prot: 47% identical to MRPC_BACPE: Na(+)/H(+) antiporter subunit C (mrpC) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K05567, multicomponent Na+:H+ antiporter subunit C (inferred from 100% identity to vch:VCA0156)

Predicted SEED Role

"Na(+) H(+) antiporter subunit C" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (117 amino acids)

>CSW01_14780 cation:proton antiporter (Vibrio cholerae E7946 ATCC 55056)
MEGLWSIVVGVFVAAGIYLMLERHLLRLLFGLILLSSAVNLAIFTAGRLTPASPPLIEVG
ALLPAEGAANPLPQALILTAIVIGFGLLVFALMLFYRAYFETRSADVDEMRRSEEEE