Protein Info for CSW01_14760 in Vibrio cholerae E7946 ATCC 55056

Annotation: Na+/H+ antiporter subunit G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details PF03334: PhaG_MnhG_YufB" amino acids 8 to 85 (78 residues), 86.6 bits, see alignment E=5.6e-29 TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 8 to 95 (88 residues), 90.1 bits, see alignment E=4.7e-30

Best Hits

Swiss-Prot: 34% identical to Y944_PYRHO: UPF0091 protein PH0944 (PH0944) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K05571, multicomponent Na+:H+ antiporter subunit G (inferred from 100% identity to vcj:VCD_000095)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>CSW01_14760 Na+/H+ antiporter subunit G (Vibrio cholerae E7946 ATCC 55056)
MSMLAALLLVLGTLFTLFASLGILRMPDLYTRMHAATKAGTAGLSLLLLAVALCMPEIGV
ISRLVGIMLFIFLTAPVAAHLLGKVTQQAGYAFWRNQDAAKQKKAQK