Protein Info for CSW01_14595 in Vibrio cholerae E7946 ATCC 55056

Annotation: type VI secretion system ATPase TssH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 869 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 858 (846 residues), 1199.9 bits, see alignment E=0 PF02861: Clp_N" amino acids 24 to 71 (48 residues), 18.8 bits, see alignment 7.3e-07 PF00004: AAA" amino acids 221 to 352 (132 residues), 38.8 bits, see alignment E=6.2e-13 amino acids 613 to 730 (118 residues), 26.9 bits, see alignment E=3e-09 PF05621: TniB" amino acids 225 to 357 (133 residues), 25.1 bits, see alignment E=5.5e-09 PF17871: AAA_lid_9" amino acids 361 to 452 (92 residues), 100.3 bits, see alignment E=2.7e-32 PF07724: AAA_2" amino acids 607 to 768 (162 residues), 171.4 bits, see alignment E=8.6e-54 PF07728: AAA_5" amino acids 612 to 733 (122 residues), 39 bits, see alignment E=3.9e-13 PF10431: ClpB_D2-small" amino acids 774 to 847 (74 residues), 42.5 bits, see alignment E=2.6e-14

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 100% identity to vcm:VCM66_A0114)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (869 amino acids)

>CSW01_14595 type VI secretion system ATPase TssH (Vibrio cholerae E7946 ATCC 55056)
MIRIELPTLIAKLNAQSKLALEQAASLCIERQHPEVTLEYYLDVLLDNPLSDVRLVLKQA
GLEVDQVKQAIASTYSREQVLDTYPAFSPLLVELLQEAWLLSSTELEQAELRSGAIFLAA
LTRADRYLSFKLISLFEGINRENLKKHFAMILSDSAETAVAKTDKNAANPLQAAAETPLG
RFCTNVTEQARNGELDPVLSRENELNLMVDILCRRRKNNPIVVGEAGVGKSAMIEGLALR
VVAGKVPTQLQNVELYSLDLGRLQAGASVKGEFEKRLKGVIDAIKQSPKPIILFIDEAHT
LIGSGNQEGGSDAANLLKPALARGELSTVAATTWKEYKKYFEKDPALTRRFQLVKLDEPT
IDQAVDILRGLNSVYEKAHNVLITDDALKAAAELSARYISGRQLPDKAIDVLDTACARIA
INMTTPPKRLALLETLCHQRQLEIDMLERAQFLGQEVDSERLDVLRNQELADEAEKAALT
QSWQQQKSLVESIIALRAELMELSQAQEQDPDHLLVVRTALQEQYQALDAIDHAERLMHP
QVDADQIAEVIADWTGVPVDQMNTDELHKITHLTSILGQAIKGQETAIERIHRHLLTARA
DLRRPGRPKGAFLLVGPSGVGKTETVVQLAEQLYGGKQFLTTINMSEYQEKHTVSRLIGS
PPGYVGYGEGGVLTEAIRKMPYSVVLLDEVEKAHPEVLNIFYQGFDKGEIADGEGRVIDC
QNIVFFLTSNLGYQTIVDYADEPAKLDEALYPELAAFFKPALLARMEVIPYLPLGKEVLA
QIVRGKLARLEKLFKTRYNAEVVIEESLIDEILSRATRSENGARMLEAIIEGQLLPPVSL
ALLNKLAERAPVERIRLAAEAGEFIGEVA