Protein Info for CSW01_14465 in Vibrio cholerae E7946 ATCC 55056

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details PF00892: EamA" amino acids 7 to 136 (130 residues), 71.1 bits, see alignment E=5.8e-24 amino acids 151 to 281 (131 residues), 65.8 bits, see alignment E=2.5e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_0050)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>CSW01_14465 EamA/RhaT family transporter (Vibrio cholerae E7946 ATCC 55056)
MSLVNLLQLLCLAAIWGGSFLFMRIAAHSFGPAYLIEARVGFAALSLFLVAQLLRRSLPI
RQHWPHFLILGLINTAVPFLLFAYAALTLNVSTLSILNSTAPIWGAVIGFLWHGTPLSRK
AVAGLLLGVSGVAVIVGWDMVAIGHHAALPMVCAALAAASYGLATNYTKQAPQLSAFENA
HGSMWAACLWVAPLMWFVPLRETPSSLEWGAVILLGVICTGLAYLIYFRLVKAIGAASTL
SVTFLIPVFGILWGYWILDEPIGLNTLFGTLLVLAGTMLVTGFSLRNARLSRQPQPH