Protein Info for CSW01_14410 in Vibrio cholerae E7946 ATCC 55056

Annotation: sodium-independent anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 77 to 87 (11 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 162 to 186 (25 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 246 to 269 (24 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 327 to 359 (33 residues), see Phobius details amino acids 378 to 408 (31 residues), see Phobius details PF00916: Sulfate_transp" amino acids 20 to 383 (364 residues), 298.1 bits, see alignment E=8.3e-93 PF01740: STAS" amino acids 443 to 535 (93 residues), 62.4 bits, see alignment E=3.1e-21

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to vcm:VCM66_A0075)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>CSW01_14410 sodium-independent anion transporter (Vibrio cholerae E7946 ATCC 55056)
MFAIYESYKAGQLQPKQWVNNITAGLIVGVVALPLAMAFAIASGVKPEQGIYTAIIAGII
VSLFGGSRVQIAGPTGAFIVILAGIVAEHGVAGLQIATIMAGFILVVLGLARLGSIIRYI
PDPVIVGFTSGIGVIIWVGQWRDFFGLPEIKGEHFHQKLVAIFHAFPQFHLTTTLLALLS
LALVIFGPKIPKLSKIPGPLLALVVVTSLQYVVGFEGVRTIGSAFGGIPQGLPEFALPDL
SLSQMIQLIGPAFAIAMLGAIESLLSAVVADGMAGTKHNSNQELVGQGIANIVAPLFGGI
AATGAIARTATNIRNGGNSPIAGVMHALTLVIILLVLAPLAVNIPLATLSAILFVVAWNM
SEAPHFVQLAKRAPRADVAILLLTFGLTVFADLVVAVNIGVIIAMLHFVKRMASSVEVKA
NGSQEMSYELAQHGRSTLPRELAVYALEGPFFFAAAETFERVMGSIQETPQILILRLKWV
PFMDITGIQTLEEMIQSFHKRGIKVLISGANSRVSQKLVKAGIVKLVGEQNVYPVFEGAL
SAALTEIEAQPTE