Protein Info for CSW01_14380 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphate ABC transporter, permease protein PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 70 to 95 (26 residues), see Phobius details amino acids 108 to 135 (28 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 14 to 283 (270 residues), 330.7 bits, see alignment E=3e-103 PF00528: BPD_transp_1" amino acids 85 to 283 (199 residues), 75.9 bits, see alignment E=1.8e-25

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to vco:VC0395_0067)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>CSW01_14380 phosphate ABC transporter, permease protein PstA (Vibrio cholerae E7946 ATCC 55056)
MDRVKLKQARVLKDNILRTFIWISAALTVGFLFWIIWYILSNGLQHVNWKFITDNYTHTG
DEHGIFPMIVSTVYMVVASIAVAAPIGIMTAIYLTEYAKVGSRLVKIIRFCTESLAGIPS
IIFGLFGMTFFVAILGLGFSILSGALTLSILILPVIIRTTEEALMAVPQTYREGSYGVGA
SKIYTIRRLILPSAMPGILTSVILSIGRVIGESAPVFLTAGMVARIPDSLLDSGRTLTVH
LYKLTTELFTIEEWNQAYGTATVLIVVVLLINMITKLIAKRFNTATY