Protein Info for CSW01_14375 in Vibrio cholerae E7946 ATCC 55056

Annotation: phosphate ABC transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 84 to 113 (30 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 29 to 303 (275 residues), 307.3 bits, see alignment E=4.6e-96 PF00528: BPD_transp_1" amino acids 106 to 302 (197 residues), 69.7 bits, see alignment E=1.4e-23

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 99% identity to vco:VC0395_0068)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>CSW01_14375 phosphate ABC transporter permease subunit PstC (Vibrio cholerae E7946 ATCC 55056)
MTIATNSDKLMDNTSMRSLREQRRVDWKERIFHGLFMTSAVIGILSLAIIAYFIVRESIP
AFQEAGVTGIVLGQDWLPPALYGVATMIVASVVSTFGAVIVGVPVGVLTAIFIAEVAPKR
VADVIRPAVELLAGIPSVVYGFFGLVIIVPLIQDVFDVPAGNTILAGIIVLGVMILPTVI
TVSETSIRAVPRAYKEGSLALGASSIYTIFKLLVPAARSGIMTGVILGIGRALGETMAII
MVMGNAPAMPEGLLDSARTLTANIAIEMSYASGIHANALYATGVVLLVFIMMLNGALLYL
NREKAR