Protein Info for CSW01_14345 in Vibrio cholerae E7946 ATCC 55056

Annotation: ligand-gated channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 28 to 713 (686 residues), 639.9 bits, see alignment E=5.4e-196 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 30 to 713 (684 residues), 571.6 bits, see alignment E=2.6e-175 PF07715: Plug" amino acids 42 to 151 (110 residues), 88.7 bits, see alignment E=5.5e-29 PF00593: TonB_dep_Rec_b-barrel" amino acids 239 to 676 (438 residues), 178.1 bits, see alignment E=9.3e-56 PF14905: OMP_b-brl_3" amino acids 404 to 706 (303 residues), 61.5 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to vco:VC0395_0074)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (713 amino acids)

>CSW01_14345 ligand-gated channel (Vibrio cholerae E7946 ATCC 55056)
MKLSPVSAAVLSVLAAGFAHAETEPSHYEEVVVTANRIEQPLSEVAGSVAVLEGETLEKQ
GKTELYDALNQEPGVSVTGGAGRPQNITIRGMTGNRIAIVRDGIQSADGYGAADINDKYG
RNTFSLSNVKQIQVVKGASSTLYGSGAIGGVVIIESKAPEDYLYHRDYYVDAALTYSGIS
NRYQGNHALAMRHGDGEALLTIDYWQGEETRNFNQDLYNREVDGYNLGFSHHYWLNDALR
LKTHLEYFDDYAKRREGTSSIQKDDKWDLVSFYEYQRSQTRLASVGADYTANLSWMDTLE
GKFYWRSTENITQTNRLMANDRSGAGILSYRRELRDEGFNDEALGATLNAQKEWQQGEWL
HQFAYGMSVDGHDYQRPKSIRRMESSGDDLQADEPFAPAREYRFGVYGQDNLLLGDWTLA
AGLRFDAQKLSPKNTDRIHGYKVVTMGSSEWSPSASISYQWHPEWNTYLSYNHGFRAPSY
DKAYGASDHSFVPLTPFIIKPNNKLRAETSDSFELGSKYDNGQTQFYVAVFYSIFDNFID
VKQVGYDNATGSVIQQYQNIAGVKTYGAEMSVMHRLDDRWSVENKLGYVDGKDGENQYVR
TLTPLEGSVQLNYQRERWDAYSRLNWASAMSRVPTCTTEQGKETECATTTGWVSWDIGLN
YQWNAQLSASFNVVNLLDREYTRYQDVAGVTPSDTLYSTEPGRYFTVHAKYVF