Protein Info for CSW01_14275 in Vibrio cholerae E7946 ATCC 55056

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 49 (22 residues), see Phobius details PF25917: BSH_RND" amino acids 66 to 236 (171 residues), 29.8 bits, see alignment E=4.4e-11

Best Hits

Swiss-Prot: 48% identical to YIAV_ECOLI: Inner membrane protein YiaV (yiaV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_000189)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>CSW01_14275 HlyD family secretion protein (Vibrio cholerae E7946 ATCC 55056)
MDLLLILTYTALCVAVFKVFKIPLNKWTVPTAVLGGVILIGTLILLMNYNHPFTQLGSQV
YSTTPIVSGVRGRVVEVPVKPNQPLTQGDVLFRIDPIPFEADVARLKAKVKEASQGALGL
ESTLKEAQAAVLKAIAERDKAQREYDRYQRGYQRGAFTEQQMDTTRQTYKAAQAALEVAQ
SKQEQAQIALDSEVGGENTTVAQLLAELRKAEFDLEQTIVRAPTDGYVTQLALRPGMMSV
PLPLAPVMTFVHTEEKIYTAAFRQNSLQRLQPGFAAEFMFRALPGKVFKGEVIEVLPAIG
ESQIQARGALLGTDALRTSGRVFVTLRITDDLSQYHLPMGSAVEVAVYSDSFEHVSIMRK
VLIRMKSWQNYLYLDH