Protein Info for CSW01_14255 in Vibrio cholerae E7946 ATCC 55056

Annotation: sodium/glutamate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 224 to 241 (18 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 380 to 404 (25 residues), see Phobius details PF03616: Glt_symporter" amino acids 5 to 376 (372 residues), 519.2 bits, see alignment E=2.4e-160 TIGR00210: sodium/glutamate symporter" amino acids 9 to 407 (399 residues), 435.1 bits, see alignment E=1.1e-134

Best Hits

KEGG orthology group: K03312, glutamate:Na+ symporter, ESS family (inferred from 100% identity to vco:VC0395_0092)

Predicted SEED Role

"Sodium/glutamate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (408 amino acids)

>CSW01_14255 sodium/glutamate symporter (Vibrio cholerae E7946 ATCC 55056)
MNQIISIGALESFLIAISVLFLGHFINAKLPILTKFNIPEPIVGGLIVACVITALHFHGI
DMEFSLPLQNVFMLMFFSTVGLAANYTQLIKGGAKVFLFLAVASVFIIIQNGVGVSLAAG
LGLDPLLGLIAGSITLSGGHGTGAAWANTFAENYGLANTLEIAMASATFGLIIGGIIGSP
VAQKLVDKHGIESEYGRGTQTHSRFPELVTYNEYEEDKVTAKKVIEILFILLICVTGAKY
LEAWVKTFEIRWLMIPDFVYALFIGVFITNLLEVTKLRKVDAETVDILGTVSLSLFLAMA
LMSLKLWNIFDLALPFLVILAIQSVVLGVFCYFVTFKVMGANYDAAVISAGHCGFGLGAT
PTAVMNMGSVVKRFGPSPQAFMVVPIVGAFFIDIVNLIILQGYISFLG