Protein Info for CSW01_14165 in Vibrio cholerae E7946 ATCC 55056

Annotation: fucose 4-O-acetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 13 to 331 (319 residues), 109.3 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_000210)

Predicted SEED Role

"Fucose 4-O-acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>CSW01_14165 fucose 4-O-acetylase (Vibrio cholerae E7946 ATCC 55056)
MPSVVMSNHQKIASLELGRVIAMLAIIALHCQLFTTYWFLDDEPWVAYLFNQSTRFAVPL
FFLISGYLIQPKLSHNPMQTLRNYCSPLLRIWVIWSVISLLMPFNLEVMVNQGYLAERSG
YWGFLLQHPLNSLFEGGLVHLWFLPALMIAVAIMALLIRQQKTHWMLPIAIGLYLYGEFA
GSSAVVTGMSAPIYTRNGPFFSTLFVVVGYLIRERHILWQSRSALLLAMLGMAFHFVEAY
GLHQYGQVFNTNDYLFGTTLWAIGLFLFLLAKPDLGRKPWGFSLSQSILGFYVSHLLVVI
MMMNLARFLGLAGLEKDTLVLFGTLLTTYLLVKGLERTPLKHLLFR