Protein Info for CSW01_14000 in Vibrio cholerae E7946 ATCC 55056

Annotation: ATP synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 TIGR01039: ATP synthase F1, beta subunit" amino acids 3 to 467 (465 residues), 820.2 bits, see alignment E=2.4e-251 PF02874: ATP-synt_ab_N" amino acids 6 to 73 (68 residues), 61.9 bits, see alignment E=9.8e-21 PF00006: ATP-synt_ab" amino acids 130 to 349 (220 residues), 231.2 bits, see alignment E=1.7e-72 PF22919: ATP-synt_VA_C" amino acids 356 to 430 (75 residues), 54.7 bits, see alignment E=1.3e-18

Best Hits

Swiss-Prot: 100% identical to ATPB_VIBCM: ATP synthase subunit beta (atpD) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 100% identity to vcm:VCM66_2684)

MetaCyc: 79% identical to ATP synthase F1 complex subunit beta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>CSW01_14000 ATP synthase subunit beta (Vibrio cholerae E7946 ATCC 55056)
MATGKIVQIIGAVVDVEFPQSEVPSVYDALNVVDSKERLVLEVQQQLGGGVIRAIVMGSS
DGLRRGMTVQNTGAPISVPVGTKTLGRIMNVLGDAIDERGDIGAEEVYSIHRPAPSYEEQ
SSATELLETGVKVIDLICPFAKGGKIGLFGGAGVGKTVNMMELINNIALQHSGLSVFAGV
GERTREGNDFYHEMQEAGVVNVEQPELSKVAMVYGQMNEPPGNRLRVALTGLTMAEKFRD
EGRDVLLFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKKGSITS
VQAVYVPADDLTDPSPATTFAHLDATVVLNRNIAAMGLYPAIDPLDSTSRQLDPLVVGQE
HYDVARGVQATLQRYKELKDIIAILGMDELSEADKQVVARARKIERFLTQPYHVAEVFTG
DPGVYVPLKETLRGFKGLLAGDYDDIPEQAFMYCGTIDDAIENAKKL