Protein Info for CSW01_13985 in Vibrio cholerae E7946 ATCC 55056

Annotation: Bcr/CflA family drug resistance efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 22 (3 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 240 to 257 (18 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 338 to 355 (18 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 5 to 371 (367 residues), 283.8 bits, see alignment E=1.5e-88 PF07690: MFS_1" amino acids 13 to 347 (335 residues), 136 bits, see alignment E=1.5e-43 PF00083: Sugar_tr" amino acids 18 to 110 (93 residues), 38.8 bits, see alignment E=5.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to vch:VC2761)

Predicted SEED Role

"Multidrug resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>CSW01_13985 Bcr/CflA family drug resistance efflux transporter (Vibrio cholerae E7946 ATCC 55056)
MKVSFFQLVYLSALSMLGFIATDMYLPAFKMMETAFATGPEQIALSLTVFLVGMALGQLL
WGLASDKFGHRNTLIAGLLVFTLASAGLAFSSTVWQLLLLRFIQAIGVCAPAVIWQAMVI
KRYPSSVSQQLFATIMPLVALSPALAPQLGVLLADYFGWHSIFLTLTLMGIVLVVSTGLQ
TNEIAEPKTTSIAQDIKGLLKSKTYLGNVMMFACASAAFFAYLTGMPEIMAQLGYQARDI
GLSFIPQTIAFMVGGYLGKKAVQKYGDELVLKQLIALFTLSAAMIFVASQWTLSSIWPIL
APFCLIAVANGAMYPIVVNRALSSAKQSPATAAGLQNSLQISVSSLSSALVAAMASQAQP
VTGIAIVLCTGGLWLGYVLSNRTLREQFTTPDNSRVVSDE