Protein Info for CSW01_13965 in Vibrio cholerae E7946 ATCC 55056

Annotation: YigZ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00257: uncharacterized protein, YigZ family
  • amino acids 4 to 201 (198 residues), 219.8 bits, E=1.3e-69
• PF01205: UPF0029
  • amino acids 20 to 127 (108 residues), 115.1 bits, E=1.6e-37
• PF09186: DUF1949
  • amino acids 143 to 197 (55 residues), 47.5 bits, E=1.3e-16

Best Hits

Swiss-Prot: 48% identical to Y722_HAEIN: IMPACT family member HI_0722 (HI_0722) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to vcm:VCM66_2677)

Predicted SEED Role

"FIG000605: protein co-occurring with transport systems (COG1739)"

Protein Sequence (210 amino acids)

>CSW01_13965 YigZ family protein (Vibrio cholerae E7946 ATCC 55056)
MNLHPYLIPMASVRFEEEIKKSLFITYLAHTPDLASAKAFVDEIKQRHADARHNCWAFVA
GRPENSMLWGLSDDGEPSGTAGKPILAQLTGSHIGEITAVVTRYYGGVLLGTGGLVKAYG
GGVQQALKRLQTIEKKITTSVHLTLDYAMIPLLHSIMAQFSATEMEAHYNEQVEMVVELE
ALQSDAFTQALINKSGAKIQVSRSPQHSQN