Protein Info for CSW01_13875 in Vibrio cholerae E7946 ATCC 55056

Annotation: adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR01430: adenosine deaminase" amino acids 6 to 329 (324 residues), 418.9 bits, see alignment E=6.3e-130 PF00962: A_deaminase" amino acids 7 to 329 (323 residues), 365 bits, see alignment E=1.8e-113

Best Hits

Swiss-Prot: 100% identical to ADD_VIBCM: Adenosine deaminase (add) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 100% identity to vco:VC0395_A2323)

MetaCyc: 69% identical to adenosine deaminase (Escherichia coli K-12 substr. MG1655)
Adenosine deaminase. [EC: 3.5.4.4]; 3.5.4.4 [EC: 3.5.4.4]

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>CSW01_13875 adenosine deaminase (Vibrio cholerae E7946 ATCC 55056)
MITSSLPLTDLHRHLDGNIRTQTILELGQKFGVKLPANTLQTLTPYVQIVEAEPSLVAFL
SKLDWGVAVLGDLDACRRVAYENVEDALNARIDYAELRFSPYYMAMKHSLPVTGVVEAVV
DGVRAGVRDFGIQANLIGIMSRTFGTDACQQELDAILSQKNHIVAVDLAGDELGQPGDRF
IQHFKQVRDAGLHVTVHAGEAAGPESMWQAIRDLGATRIGHGVKAIHDPKLMDYLAQHRI
GIESCLTSNLQTSTVDSLATHPLKRFLEHGILACINTDDPAVEGIELPYEYEVAAPQAGL
SQEQIRQAQLNGLELAFLSDSEKKALLAKAALRG