Protein Info for CSW01_13865 in Vibrio cholerae E7946 ATCC 55056

Annotation: nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 TIGR01818: nitrogen regulation protein NR(I)" amino acids 6 to 465 (460 residues), 825.2 bits, see alignment E=7.7e-253 PF00072: Response_reg" amino acids 6 to 115 (110 residues), 101.7 bits, see alignment E=8.4e-33 PF00158: Sigma54_activat" amino acids 141 to 308 (168 residues), 244.8 bits, see alignment E=1.1e-76 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 82.8 bits, see alignment E=8.3e-27 PF07724: AAA_2" amino acids 161 to 286 (126 residues), 28 bits, see alignment E=6.5e-10 PF07728: AAA_5" amino acids 165 to 284 (120 residues), 32.5 bits, see alignment E=2.4e-11 PF02954: HTH_8" amino acids 425 to 465 (41 residues), 55.3 bits, see alignment 1.3e-18

Best Hits

Swiss-Prot: 68% identical to NTRC_PROHU: DNA-binding transcriptional regulator NtrC (ntrC) from Proteus hauseri

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to vcj:VCD_001619)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>CSW01_13865 nitrogen regulation protein NR(I) (Vibrio cholerae E7946 ATCC 55056)
MSRGYVWVVDDDSSIRWVMEKTLSSAHIKCETFADAESVLLALERETPDVLVSDIRMPGM
DGIALLNQVHQRTPELPVIIMTAHSDLDAAVNAYQQGAFEYLPKPFDVDETLTLVERAIA
HGQEQRKTSHRPSENYSAPEIIGEAPAMQEVFRAIGRLSRSSISVLINGESGTGKELVAH
ALHRHSPRAQKPFIALNMAAIPKDLIESELFGHEKGAFTGANTVRQGRFEQANGGTLFLD
EIGDMPLDIQTRLLRVLADGQFYRVGGHVAIKVDVRIVAATHQNLEKLVHQGKFREDLFH
RLNVIRIHIPSLRERRQDIEKLTKHFLALAAKELGVEMKTLNPRTVDILTKLDWPGNVRQ
LENMCRWLTVMASGSEVLPSDLPSELLSERKASHFDNDISWQKQLETWAKSALASGETEL
LAYALPEFERILLEAALHHTNGHKQEAAKVLGWGRNTLTRKLKELY