Protein Info for CSW01_13830 in Vibrio cholerae E7946 ATCC 55056

Annotation: YihY/virulence factor BrkB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 35 to 63 (29 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 241 to 267 (27 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 17 to 275 (259 residues), 269.1 bits, see alignment E=2.6e-84 PF03631: Virul_fac_BrkB" amino acids 28 to 276 (249 residues), 218.9 bits, see alignment E=4.9e-69

Best Hits

Swiss-Prot: 100% identical to Y2662_VIBCM: UPF0761 membrane protein VCM66_2662 (VCM66_2662) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to vcm:VCM66_2662)

Predicted SEED Role

"Inner membrane protein YihY, formerly thought to be RNase BN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>CSW01_13830 YihY/virulence factor BrkB family protein (Vibrio cholerae E7946 ATCC 55056)
MKLTHSFIKQQARLGLNFFRYLLARMNHDRVNVNAGYLAYITLLSMVPMLTVLLSILSSF
ALFANAGEVIQDFVITHFVPAAGEVVKTALIEFVANTGKMTAVGGAFLFVAAIMLISNID
KNLNYIWRVQQKRRAVFSFSMYWMILTLGPILVGASIAATSYITSLKILDNEALSGVYNL
FLRWLPFVLSYCAFVGLYLLVPNKKVHWQHAMLGALIAAILFELSKKGFAAYITQFPSYQ
LIYGALAAIPILFVWVYLCWLIVLVGAEVTAALGEREHWSDSQDMLHFAPLPKNEKE