Protein Info for CSW01_13570 in Vibrio cholerae E7946 ATCC 55056

Annotation: fructose-bisphosphatase class II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR00330: fructose-1,6-bisphosphatase, class II" amino acids 1 to 329 (329 residues), 562.9 bits, see alignment E=1.1e-173 PF03320: FBPase_glpX" amino acids 3 to 321 (319 residues), 426.6 bits, see alignment E=2.2e-132

Best Hits

Swiss-Prot: 80% identical to GLPX_ECOL6: Fructose-1,6-bisphosphatase class 2 (glpX) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02446, fructose-1,6-bisphosphatase II [EC: 3.1.3.11] (inferred from 100% identity to vco:VC0395_A2260)

MetaCyc: 80% identical to fructose-1,6-bisphosphatase 2 (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphatase. [EC: 3.1.3.11]

Predicted SEED Role

"Fructose-1,6-bisphosphatase, GlpX type (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>CSW01_13570 fructose-bisphosphatase class II (Vibrio cholerae E7946 ATCC 55056)
MKRDLAMAFSRVTEGAALAGYKWLGRGDKNAADGAAVEVMRILLNQTEISGEIVIGEGEI
DEAPMLYIGEQVGLGGDAVDIAVDPIEGTRMTAMGQSNALAVLAAGEKGSFLKAPDMYME
KLVVGPGAKGCIDLNLPLKDNLNHVAKALGKPLTDLVVITLAKPRHDQVIAQMQQMGVRV
FAVPDGDVAASILTCMPDSEVDMMYCIGGAPEGVVSAAVIRALDGDMQGRLLPRHQVKGD
SEDNRIWGAKELERCQQMGVEAGKVLKMEDMARSDNVIFAATGITKGDLLDGISRKGNIA
TTETLLIRGRCRTIRRIRSIHYLERKDQQVRDIIL