Protein Info for CSW01_13440 in Vibrio cholerae E7946 ATCC 55056

Annotation: fumarate reductase subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02313: Fumarate_red_D
  • amino acids 16 to 127 (112 residues), 150.6 bits, E=1e-48

Best Hits

Swiss-Prot: 100% identical to FRDD_VIBCM: Fumarate reductase subunit D (frdD) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K00247, fumarate reductase subunit D (inferred from 100% identity to vcm:VCM66_2579)

MetaCyc: 52% identical to fumarate reductase membrane protein FrdD (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Fumarate reductase subunit D" in subsystem Succinate dehydrogenase

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• mixed acid fermentation (15/16 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle III (animals) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• glycerol-3-phosphate to fumarate electron transfer (2/2 steps found)
• succinate to cytochrome bd oxidase electron transfer (2/2 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• reductive TCA cycle I (8/11 steps found)
• incomplete reductive TCA cycle (5/7 steps found)
• NADH to fumarate electron transfer (1/2 steps found)
• hydrogen to fumarate electron transfer (1/2 steps found)
• succinate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• succinate to cytochrome bo oxidase electron transfer (1/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (6/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• reductive TCA cycle II (8/12 steps found)
• TCA cycle VII (acetate-producers) (5/9 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (6/13 steps found)
• methylaspartate cycle (9/19 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (24/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Oxidative phosphorylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.5.1

Protein Sequence (130 amino acids)

>CSW01_13440 fumarate reductase subunit D (Vibrio cholerae E7946 ATCC 55056)
MFLLWCKELIVINTNPKRSDEPVWWSLFGAGGTWFAMITPITVLVLGILAPLGVIDAEAL
SYERVSSFATSIIGALFIIGTLALPMWHAMHRVHHGMHDLKFHTGVAGKIACYGFATIIS
ALAVVFIFMI