Protein Info for CSW01_13405 in Vibrio cholerae E7946 ATCC 55056

Annotation: glycerol-3-phosphate dehydrogenase (NAD(P)(+))

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01210: NAD_Gly3P_dh_N
  • amino acids 16 to 171 (156 residues), 166.2 bits, E=1.5e-52
• PF02558: ApbA
  • amino acids 17 to 123 (107 residues), 23.4 bits, E=1e-08
• PF07479: NAD_Gly3P_dh_C
  • amino acids 192 to 330 (139 residues), 192.7 bits, E=8.6e-61
• PF20618: GPD_NAD_C_bact
  • amino acids 252 to 318 (67 residues), 88 bits, E=1.2e-28

Best Hits

Swiss-Prot: 100% identical to GPDA_VIBC3: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 100% identity to vcj:VCD_001714)

MetaCyc: 75% identical to glycerol-3-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase (NAD(P)(+)). [EC: 1.1.1.94]

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• CDP-diacylglycerol biosynthesis III (4/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Protein Sequence (344 amino acids)

>CSW01_13405 glycerol-3-phosphate dehydrogenase (NAD(P)(+)) (Vibrio cholerae E7946 ATCC 55056)
MSETQNHNSYGKPVEMTVIGAGSYGTSLAISLARNGANIVLWGHDAEHMARLDADRANHE
FLPGIAFPDTLIVETDLQKAVQASRDLLVVVPSHVFGIVLKSLQPHLRADSRICWATKGL
EPETGRLLQDVAHDVLGDSYPLAVLSGPTFAKELAMGMPTAISVASPDAQFVRDLQEKIH
CSKTFRVYANSDFIGMQLGGAVKNVIAIGAGMSDGIGFGANARTALITRGLAEMSRLGAA
LGAQPETFMGMAGLGDLVLTCTDNQSRNRRFGLALGQGKDVDTAQTDIGQVVEGYRNTKE
VWMLAKRMGVEMPIVEQIYQVLYQGKDARLAAQDLLARDKKMER