Protein Info for CSW01_13345 in Vibrio cholerae E7946 ATCC 55056

Annotation: glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF08534: Redoxin" amino acids 9 to 164 (156 residues), 110.4 bits, see alignment E=1.4e-35 PF00578: AhpC-TSA" amino acids 11 to 137 (127 residues), 47 bits, see alignment E=4.7e-16 TIGR02190: glutaredoxin-family domain" amino acids 168 to 245 (78 residues), 131.9 bits, see alignment E=3e-43 PF00462: Glutaredoxin" amino acids 177 to 235 (59 residues), 66.4 bits, see alignment E=4.3e-22 PF13417: GST_N_3" amino acids 180 to 245 (66 residues), 30.3 bits, see alignment E=8.4e-11

Best Hits

Swiss-Prot: 82% identical to PRX5_HAEIN: Hybrid peroxiredoxin hyPrx5 (PGdx) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to vco:VC0395_A2214)

Predicted SEED Role

"Peroxiredoxin family protein/glutaredoxin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>CSW01_13345 glutathione peroxidase (Vibrio cholerae E7946 ATCC 55056)
MRNTMFTSKEGQTIPQVTFPTRQGDAWVNVTSDELFKGKTVIVFSLPGAFTPTCSSTHLP
RYNELFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNADNITFIPDGNGEFTDGMGMLVDK
NDLGFGKRSWRYSMLVKDGVVEKMFIEPNEPGDPFKVSDADTMLKYIAPQYKVQESVTIF
TKPGCPYCAKAKQALIDAGLQYEELILGKDATTVSLRAVSGRTTVPQVFIGGKHIGGSDD
LEVYLNQ