Protein Info for CSW01_13340 in Vibrio cholerae E7946 ATCC 55056

Annotation: DNA-binding transcriptional regulator OxyR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF00126: HTH_1" amino acids 3 to 61 (59 residues), 74.5 bits, see alignment E=5.1e-25 PF03466: LysR_substrate" amino acids 89 to 293 (205 residues), 152 bits, see alignment E=1.6e-48

Best Hits

Swiss-Prot: 64% identical to OXYR_DICCH: Hydrogen peroxide-inducible genes activator (oxyR) from Dickeya chrysanthemi

KEGG orthology group: K04761, LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator (inferred from 100% identity to vcj:VCD_001727)

MetaCyc: 64% identical to DNA-binding transcriptional dual regulator OxyR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Hydrogen peroxide-inducible genes activator" in subsystem DNA-binding regulatory proteins, strays or Oxidative stress or Thioredoxin-disulfide reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>CSW01_13340 DNA-binding transcriptional regulator OxyR (Vibrio cholerae E7946 ATCC 55056)
MNIRDFEYLVALADHKHFRKAAEACFVSQPTLSGQIRKLEDEIGTTLLERSSRRVLFTEA
GLQLVDQAKKILSEVKTFKDMANQQTGAMTGPLHIGFIPTLGPYLLPKIIPTLKERFPEL
ELYLHEAQTNQLVRQLEEGKLDCLVLASVEETAPFKEIELYNEVLSIAVPCDHAWAARDE
VDMLELKGKTVLALGDGHCLRDQALGFCFAAGAKDDERFKATSLETLRNMVAAGAGITLL
PELALPEDKTKDGVCYLRAVNPIPSRRLVLAYRPGSPLRQRFEQLAEVIKHRLQQSE