Protein Info for CSW01_13335 in Vibrio cholerae E7946 ATCC 55056
Annotation: penicillin-binding protein 1A
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PBPA_VIBCH: Penicillin-binding protein 1A (mrcA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
KEGG orthology group: K05366, penicillin-binding protein 1A [EC: 2.4.1.- 3.4.-.-] (inferred from 100% identity to vcm:VCM66_2555)Predicted SEED Role
"Multimodular transpeptidase-transglycosylase (EC 2.4.1.129) (EC 3.4.-.-)" in subsystem Peptidoglycan Biosynthesis or Type IV pilus (EC 2.4.1.129, EC 3.4.-.-)
MetaCyc Pathways
- peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
- peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
- peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
- peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
- peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)
- peptidoglycan maturation (meso-diaminopimelate containing) (4/12 steps found)
KEGG Metabolic Maps
- Anthocyanin biosynthesis
- Biotin metabolism
- Carotenoid biosynthesis - General
- Flavone and flavonol biosynthesis
- Flavonoid biosynthesis
- Fructose and mannose metabolism
- Glycerolipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Glycosphingolipid biosynthesis - globo series
- Glycosphingolipid biosynthesis - lacto and neolacto series
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
- High-mannose type N-glycan biosynthesis
- Keratan sulfate biosynthesis
- Lipopolysaccharide biosynthesis
- Lysine degradation
- N-Glycan biosynthesis
- O-Glycan biosynthesis
- O-Mannosyl glycan biosynthesis
- Peptidoglycan biosynthesis
- Sphingolipid metabolism
- Zeatin biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.4.1.-, 2.4.1.129, 3.4.-.-
Use Curated BLAST to search for 2.4.1.- or 2.4.1.129 or 3.4.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (835 amino acids)
>CSW01_13335 penicillin-binding protein 1A (Vibrio cholerae E7946 ATCC 55056) MQPQLNRDSPVKFIKRLLVFSLICIILGVTTIFGFYFYVKSDLPDVATLRDVQLQTPMQV FSQDGKLIAQFGEKRRIPLKLEEMPKELIEAVIATEDSRYYEHYGFDPIGITRAAFAVLA SGSASQGASTITQQLARNFFLSNEKKVMRKVKEIFIAIHIEQLLSKQEILELYLNKIYLG YRSYGVGAAAQAYFGKEVKDLTLGEIALIAGLPKAPSTMNPIYSVERATNRRNVVLQRML DEKYITKAEYDAARAEPVLPKYHGAEIELNAPYVAEIARAWMVERYGEEAAYTSGMNVYT TVDSKLQRAANQAAINNLLAYDERHGYRGAEKELWQVNQPAWSSTQLSEYLSNEPTYGDM FPAAVLSVEEKSAQVWVKSYGVQTIAWEDMNWARRFINDDRQGPLPKSANEFLAAGQQIW VRPRTQDGAITAWKLTQVPNANTAFVAMNPENGAVTALVGGFNFVHNKFNRATQSVRQVG SSIKPFIYSAALNKGLTLATLINDAPINQWDESQGTAWRPKNSPPTYTGPTRLRIGLAQS KNVMAVRVLREVGLDETREYLTRFGFKLDQLPRSETIALGAGSLTPVQMAQGFSVFANNG YFVEPFYISRVENPFGNIEFSAEPKVVCHRECSSELDEFAEQDAASPYAPKVISEQNAFL TREMLYSNIWGGGEWSSDTGWNGTGWRAQALKRRDIGGKTGTTNDSKDAWYNGYAPGIVG VAWVGFDDHSRNLGKTAPNRNIEDDVSGAESGGKTALPAWVEFMSLALQDVPVQQKAVPN NIARVRIDRDTGLLTNKLDSSSMFEYFEAGTEPTEYVSEHVNESIYSTSSGEELF