Protein Info for CSW01_13330 in Vibrio cholerae E7946 ATCC 55056

Annotation: pilus assembly protein PilM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR01175: type IV pilus assembly protein PilM" amino acids 3 to 329 (327 residues), 433.9 bits, see alignment E=2.1e-134 PF11104: PilM_2" amino acids 8 to 221 (214 residues), 110.2 bits, see alignment E=5.4e-36 amino acids 240 to 328 (89 residues), 51.8 bits, see alignment E=3.2e-18

Best Hits

KEGG orthology group: K02662, type IV pilus assembly protein PilM (inferred from 100% identity to vco:VC0395_A2211)

Predicted SEED Role

"Type IV pilus biogenesis protein PilM" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>CSW01_13330 pilus assembly protein PilM (Vibrio cholerae E7946 ATCC 55056)
MGKSLVTGIDIGHHSIKAAVLKPMGDTYALVGYEELLVTADIFTDNHTLDYQKIVKKLKE
LKKGLPLFSHKVAIAIPDSAVISKVLQIDSDLEQRELEFAVYQAFSHQSPFPVEELSLDF
VKVTEKSLARSSTTTFQVYATKKDVVDSRLHAVKKAGFEPVLMDVQVHSLLHLWQLASRA
YRRPDWMLVDIGYTQSSLCLDFPEKMPFYKDVPLGTRQLESEPSAVNSLNHPLLHDPTQR
FIQELVDKIARQIQLFTSVHGTQSLGGLWLSGGGATLSGLEDALYQRLSLPCEVLNPFSL
FKNNVAKRKRPLVDGQRFSTAAGLALRGLAWLESEHVA