Protein Info for CSW01_13310 in Vibrio cholerae E7946 ATCC 55056

Annotation: type IV pilus secretin PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF11741: AMIN" amino acids 48 to 136 (89 residues), 38.1 bits, see alignment E=2.7e-13 TIGR02515: type IV pilus secretin PilQ" amino acids 163 to 576 (414 residues), 531.6 bits, see alignment E=8e-164 PF03958: Secretin_N" amino acids 262 to 327 (66 residues), 48.1 bits, see alignment E=2.2e-16 PF00263: Secretin" amino acids 418 to 576 (159 residues), 163.6 bits, see alignment E=6.7e-52

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 100% identity to vcm:VCM66_2550)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (578 amino acids)

>CSW01_13310 type IV pilus secretin PilQ (Vibrio cholerae E7946 ATCC 55056)
MKYRDITMKNGLKTYVAQTWLTLWVGLALCASSMVFSAESATANQLENIDFRVNKEKAAV
LIVELASPSAVVDVQKVQEGLSIELLKTDVADDKLYLLDVKDFSTPVESVEVFRKEPSTQ
LVVTVDGEFQHDYTLKGKYLEVVISKLKADEKPKPKSVLEKEGKLISINFQDIPVRNVLQ
LIADYNGFNLVVSDSVVGNLTLRLDGVPWQQVLDIILQVKGLDKRVDGNVILIAPKEELD
LREKQALEKARLAEELGDLKSEIIKINFAKASDIAAMIGGEGNVNMLSERGSISIDERTN
SLLIRELPDNIAVIREIIESLDIPVKQVQIEARIVTVKEGNLEELGVRWGVMSTNGSHSV
GGSIESNLWQKGLLADDEFPVDEFLNVNLASTSANASSIAFQVAKLGSGTLLDLELSALQ
NESKAEIISSPRLITTNKQPAYIEQGTEIPYLESSSSGASTVAFKKAVLSLKVTPQITPD
NRLVLDLSVTQDRRGETVKTGTGEAVSIDTQRIGTQVLVNNGETVVLGGIFQHSINNSVD
KVPLLGDLPVLGALFRRTYEQMGKSELLIFVTPKVVIQ