Protein Info for CSW01_13305 in Vibrio cholerae E7946 ATCC 55056

Annotation: shikimate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13238: AAA_18
  • amino acids 7 to 119 (113 residues), 30.5 bits, E=1.1e-10
• PF13671: AAA_33
  • amino acids 7 to 45 (39 residues), 31.7 bits, 4.6e-11
• PF01202: SKI
  • amino acids 13 to 169 (157 residues), 200.8 bits, E=3.9e-63

Best Hits

Swiss-Prot: 100% identical to AROK_VIBC3: Shikimate kinase (aroK) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 100% identity to vch:VC2629)

MetaCyc: 82% identical to shikimate kinase 1 (Escherichia coli K-12 substr. MG1655)
Shikimate kinase. [EC: 2.7.1.71]

Predicted SEED Role

"Shikimate kinase I (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

• superpathway of chorismate metabolism (51/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.71

Protein Sequence (174 amino acids)

>CSW01_13305 shikimate kinase (Vibrio cholerae E7946 ATCC 55056)
MAEKRNIFLVGPMGAGKSTIGRHLAQQLHMEFIDSDTVIEERTGADIAWVFDVEGEEGFR
KREEAVINDLTEQQGIVLATGGGSVISKENRNRLSARGIVVYLETTIEKQLARTNRDKKR
PLLQTDCPREVLEQLAEDRNPLYEEIADITVRTDDQSAKVVANQIVKMLEEHIM