Protein Info for CSW01_13145 in Vibrio cholerae E7946 ATCC 55056

Annotation: 30S ribosomal protein S10

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 TIGR01049: ribosomal protein uS10" amino acids 4 to 101 (98 residues), 151.9 bits, see alignment E=2.5e-49 PF00338: Ribosomal_S10" amino acids 7 to 100 (94 residues), 123 bits, see alignment E=2.7e-40

Best Hits

Swiss-Prot: 100% identical to RS10_VIBCH: 30S ribosomal protein S10 (rpsJ) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02946, small subunit ribosomal protein S10 (inferred from 95% identity to hif:HIBPF15390)

MetaCyc: 93% identical to 30S ribosomal subunit protein S10 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S10p (S20e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (103 amino acids)

>CSW01_13145 30S ribosomal protein S10 (Vibrio cholerae E7946 ATCC 55056)
MQNQRIRIRLKAFDYKLIDASTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD
ARDQYEIRTHKRLIDIVEPTDKTVDALMRLDLAAGVDVQISLG