Protein Info for CSW01_13130 in Vibrio cholerae E7946 ATCC 55056

Annotation: 50S ribosomal protein L23

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 PF00276: Ribosomal_L23" amino acids 9 to 95 (87 residues), 112.8 bits, see alignment E=4.2e-37

Best Hits

Swiss-Prot: 100% identical to RL23_VIBC3: 50S ribosomal protein L23 (rplW) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K02892, large subunit ribosomal protein L23 (inferred from 100% identity to vcm:VCM66_2514)

MetaCyc: 81% identical to 50S ribosomal subunit protein L23 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L23p (L23Ae)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (100 amino acids)

>CSW01_13130 50S ribosomal protein L23 (Vibrio cholerae E7946 ATCC 55056)
MIREERLLKVLRAPHISEKATMSAEKSNTIVFKVAKDATKKEIKAAVEKLFEVEVKSVNT
LIIKGKTKRQGLRQGRRSDVKKAYVTLNEGQDLDFVGGAE