Protein Info for CSW01_13055 in Vibrio cholerae E7946 ATCC 55056

Annotation: 30S ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 10 to 163 (154 residues), 228.1 bits, E=2.1e-72
• PF00333: Ribosomal_S5
  • amino acids 12 to 75 (64 residues), 100.7 bits, E=3.6e-33
• PF03719: Ribosomal_S5_C
  • amino acids 88 to 158 (71 residues), 101.5 bits, E=1.4e-33

Best Hits

Swiss-Prot: 100% identical to RS5_VIBCH: 30S ribosomal protein S5 (rpsE) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 99% identity to vvu:VV1_0743)

MetaCyc: 84% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Protein Sequence (167 amino acids)

>CSW01_13055 30S ribosomal protein S5 (Vibrio cholerae E7946 ATCC 55056)
MAKEQQVQANDLQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRSMVTIALNEGTLHHPVKGRHSGSKVYMQPAAEGTGVIAGGAMRAVLEVAG
VHNVLSKAYGSTNPINIVRATIDALVDVKSPEMVAAKRGLTVEAISE