Protein Info for CSW01_12990 in Vibrio cholerae E7946 ATCC 55056

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details PF00892: EamA" amino acids 7 to 137 (131 residues), 57.6 bits, see alignment E=8.7e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to vcj:VCD_001797)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>CSW01_12990 EamA family transporter (Vibrio cholerae E7946 ATCC 55056)
MNPVALAVWLLVLGNLAASLSDVAVKMLQGEVVPFQYMFLRQLFAFALIWPVWRKQPKVL
RQLNDPKVTLIRAHLVLLGAGCMVVAISYLPLATANAVFYAAPLLMLPLSILFLKERPSR
GKVIATVTGFLGVLIVLRPSQFHWAALFALGTACSLALFNLLARTIPERQPVVTTLMWTT
LFSLPISGLLAAAYWQPLSLSQWLWIAASSGLIFVAAFGAFWFAEMLDALTWLGIGMIIL
PLLPSAWLAKWWELLTAPKATIRETEEHH